PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0042s0119.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 662aa    MW: 75205.6 Da    PI: 8.7704
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0042s0119.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B351.71.6e-16491152799
                          ---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                   B3  27 ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                          +g+k ++   +l  +sg+ W+v+l  + + ++  +t+GWk+Fv++n++++gDf+vF++d+++ef  +v+++++
  Kaladp0042s0119.1.p  49 EGVKSGP--AKLIGLSGEAWRVRL--EHNEDGLCFTEGWKDFVNDNEVETGDFLVFSYDEEMEF--RVTIYDQ 115
                          5565555..8899***********..99999***************************998999..8888875 PP

2B368.59.4e-222413171595
                          -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                   B3  15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                            ++p +f++eh+++ +++ +++l++e +++W+vk+   k++++yv+t+GW +Fv++n+LkegD+++F+l++r e  l+++
  Kaladp0042s0119.1.p 241 TQCIPSTFISEHDLSYKKNEKVRLQNEGNKRWSVKV--VKHGCTYVFTAGWPQFVRDNELKEGDICIFELQSRLE--LRLH 317
                          458*********777778889***************..*******************************976544..3444 PP

3B337.63.9e-123444151385
                          TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE..EEE-TTHHHHHHHHT--TT-EEEEEE- CS
                   B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr..yvltkGWkeFvkangLkegDfvvFkld 85 
                          +  + +p +f ++ ++ k +   ++l+d+sg+ + v+++ r +s++  +++  GW +F ++n+Lk+gD + F+ +
  Kaladp0042s0119.1.p 344 RPYMNIPQTFSDNVMLRKGS--HVKLRDSSGKLYPVTITCRAHSEAnvHMIN-GWHQFFQSNKLKVGDACEFRTS 415
                          35689*****9888988655..6***************99999999956655.*******************943 PP

4B352.31e-16473557898
                          -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
                   B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                          + +++sgrl +p kf ++++g   +++ + l  + g++W+v l   ++ ++ +l +GW++Fv++  ++ gD++vF+++g+ +f   v +f
  Kaladp0042s0119.1.p 473 APHSSSGRLEIPHKFNQHIEGR--TNVWVLLSGRGGKVWRVGL--VRQHQTLFLNEGWSGFVRDSSVELGDILVFEYNGDWQF--EVYIF 556
                          6678899********9888877..678899999**********..9*******************************998888..88888 PP

                          - CS
                   B3  98 r 98 
                          +
  Kaladp0042s0119.1.p 557 D 557
                          7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010195.2E-106116IPR003340B3 DNA binding domain
CDDcd100179.22E-1545114No hitNo description
PfamPF023623.3E-1350115IPR003340B3 DNA binding domain
SuperFamilySSF1019362.35E-1751118IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-1752117IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.29658116IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.4E-20185203IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.846227322IPR003340B3 DNA binding domain
CDDcd100172.65E-15232308No hitNo description
SuperFamilySSF1019363.14E-17236320IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.0E-10237322IPR003340B3 DNA binding domain
PfamPF023625.1E-18242318IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.4E-20243320IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.0E-14326415IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.53E-13327414IPR015300DNA-binding pseudobarrel domain
CDDcd100172.26E-9331413No hitNo description
SMARTSM010190.0029331428IPR003340B3 DNA binding domain
PROSITE profilePS5086310.489332428IPR003340B3 DNA binding domain
PfamPF023627.7E-9345414IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.0E-23460561IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.16E-22461561IPR015300DNA-binding pseudobarrel domain
CDDcd100172.00E-15466557No hitNo description
PROSITE profilePS5086314.24466559IPR003340B3 DNA binding domain
SMARTSM010197.9E-13468559IPR003340B3 DNA binding domain
PfamPF023622.3E-14473558IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MSRASICQPL IPGNRSTLDR LATGGKSAHR MNPSARSLVQ IGLFKYYIEG VKSGPAKLIG  60
LSGEAWRVRL EHNEDGLCFT EGWKDFVNDN EVETGDFLVF SYDEEMEFRV TIYDQTSCEK  120
EAALRAICSQ GLRECEEQNE QQNEREKPVG MALKCGSLKR KRSGQGLLIP EETELVEVAE  180
SFWSTYPFFV VRLKGYNVRG AQISFGLLGV TRSSVVFSVI IFARYLTYYI DTSESIFVRF  240
TQCIPSTFIS EHDLSYKKNE KVRLQNEGNK RWSVKVVKHG CTYVFTAGWP QFVRDNELKE  300
GDICIFELQS RLELRLHHRQ KQTESTEVTG FSTIIRPANA SRKRPYMNIP QTFSDNVMLR  360
KGSHVKLRDS SGKLYPVTIT CRAHSEANVH MINGWHQFFQ SNKLKVGDAC EFRTSMRPRL  420
LRTLRSGPHK VTRNCATMRN SAKQKQASKM ATATTSPVKS SDGRKPHFIV TFAPHSSSGR  480
LEIPHKFNQH IEGRTNVWVL LSGRGGKVWR VGLVRQHQTL FLNEGWSGFV RDSSVELGDI  540
LVFEYNGDWQ FEVYIFDGSG CEKEVRECMG NLGSNSRKKR ERDEDESSGC VVKKKESIVC  600
RSCTVDCVNE EPADLSTAEC HPGAPVGEPL ALISIFLSQI WNLHLKSYFT WINWLHSYII  660
N*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34400.11e-15B3 family protein